Recombinant Human Polypeptide GalNac Transferase 1/GALNT1 Protein

Order Details


    • Catalog Number
      H00002589-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Polypeptide GalNac Transferase 1/GALNT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-105 of Human GALNT1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEG

Protein/Peptide Type
Recombinant Protein
Gene
GALNT1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Polypeptide GalNac Transferase 1/GALNT1 Protein

  • EC 2.4.1.41
  • GalNAc transferase 1
  • GALNAC-T1
  • GALNT1
  • Polypeptide GalNAc transferase 1
  • polypeptide N-acetylgalactosaminyltransferase 1
  • pp-GaNTase 1
  • Protein-UDP acetylgalactosaminyltransferase 1
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1)

Background

This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7174
Species: Hu
Applications: WB, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-88662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF7528
Species: Hu
Applications: WB
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84046
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
259-HE
Species: Hu
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-06499
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
H00002589-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01) (0)

There are no publications for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01) (0)

There are no reviews for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Polypeptide GalNac Transferase 1/GALNT1 Products

Bioinformatics Tool for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01)

Discover related pathways, diseases and genes to Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01)

Discover more about diseases related to Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01).
 

Pathways for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01)

View related products by pathway.

PTMs for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01)

Learn more about PTMs related to Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01).
 

Research Areas for Polypeptide GalNac Transferase 1/GALNT1 Recombinant Protein (H00002589-P01)

Find related products by research area.

Blogs on Polypeptide GalNac Transferase 1/GALNT1

There are no specific blogs for Polypeptide GalNac Transferase 1/GALNT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Polypeptide GalNac Transferase 1/GALNT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT1
Entrez