Polycystin 2 Antibody (4C8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Polycystin 2 Primary Antibodies

Order Details


    • Catalog Number
      H00005311-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Polycystin 2 Antibody (4C8) [DyLight 488] Summary

Immunogen
PKD2 (NP_000288 261 a.a. - 360 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
Specificity
PKD2 - polycystic kidney disease 2 (autosomal dominant)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Polycystin 2 Antibody (4C8) [DyLight 488]

  • APKD2
  • Autosomal dominant polycystic kidney disease type II protein
  • MGC138466
  • MGC138468
  • PC2
  • Pc-2
  • PKD4
  • polycystic kidney disease 2 (autosomal dominant)
  • Polycystic kidney disease 2 protein
  • polycystin-2
  • polycystwin
  • R48321
  • transient receptor potential cation channel, subfamily P, member 2
  • TRPP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow

Publications for Polycystin 2 Antibody (H00005311-M01G) (0)

There are no publications for Polycystin 2 Antibody (H00005311-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polycystin 2 Antibody (H00005311-M01G) (0)

There are no reviews for Polycystin 2 Antibody (H00005311-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Polycystin 2 Antibody (H00005311-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Polycystin 2 Products

Bioinformatics Tool for Polycystin 2 Antibody (H00005311-M01G)

Discover related pathways, diseases and genes to Polycystin 2 Antibody (H00005311-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polycystin 2 Antibody (H00005311-M01G)

Discover more about diseases related to Polycystin 2 Antibody (H00005311-M01G).
 

Pathways for Polycystin 2 Antibody (H00005311-M01G)

View related products by pathway.

PTMs for Polycystin 2 Antibody (H00005311-M01G)

Learn more about PTMs related to Polycystin 2 Antibody (H00005311-M01G).
 

Research Areas for Polycystin 2 Antibody (H00005311-M01G)

Find related products by research area.

Blogs on Polycystin 2

There are no specific blogs for Polycystin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Polycystin 2 Antibody (4C8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PKD2