POLR1B Antibody (4H6) [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related POLR1B Primary Antibodies

Order Details


    • Catalog Number
      H00084172-M10AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

POLR1B Antibody (4H6) [Alexa Fluor® 700] Summary

Immunogen
POLR1B (NP_061887, 963 a.a. ~ 1072 a.a) partial recombinant protein with GST tag. GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVK
Specificity
POLR1B (4H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLR1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
Alexa Fluor 700
Format
Alexa Fluor 700 (A=675-700, E=723)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for POLR1B Antibody (4H6) [Alexa Fluor® 700]

  • DNA-directed RNA polymerase I 135 kDa polypeptide
  • DNA-directed RNA polymerase I 135kDa polypeptide
  • DNA-directed RNA polymerase I subunit RPA2
  • EC 2.7.7.6
  • FLJ10816
  • FLJ21921
  • MGC131780
  • polymerase (RNA) I polypeptide B, 128kDa
  • RNA polymerase I subunit 2
  • RPA116
  • RPA135
  • RPA2
  • Rpo1-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-159
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
MAB7445
Species: Hu
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IP
NB100-215
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for POLR1B Antibody (H00084172-M10AF700) (0)

There are no publications for POLR1B Antibody (H00084172-M10AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1B Antibody (H00084172-M10AF700) (0)

There are no reviews for POLR1B Antibody (H00084172-M10AF700). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR1B Antibody (H00084172-M10AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR1B Products

Related Products by Gene

Bioinformatics Tool for POLR1B Antibody (H00084172-M10AF700)

Discover related pathways, diseases and genes to POLR1B Antibody (H00084172-M10AF700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1B Antibody (H00084172-M10AF700)

Discover more about diseases related to POLR1B Antibody (H00084172-M10AF700).
 

Pathways for POLR1B Antibody (H00084172-M10AF700)

View related products by pathway.

Blogs on POLR1B

There are no specific blogs for POLR1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol POLR1B

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00084172-M10AF700 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.