Recombinant Human PNKD Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PNKD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-385 of Human PNKD full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGKEEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PNKD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PNKD Protein

  • BRP17FKSG19
  • DKFZp564N1362
  • DYT8paroxysmal nonkinesiogenic dyskinesia
  • FPD1brain protein 17
  • KIAA1184Myofibrillogenesis regulator 1
  • KIPP1184probable hydrolase PNKD
  • MGC31943
  • MR1Paroxysmal nonkinesiogenic dyskinesia protein
  • MR-1Trans-activated by hepatitis C virus core protein 2
  • paroxysmal nonkinesigenic dyskinesia
  • PDCEC 3.-
  • TAHCCP2PKND1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PNKD Recombinant Protein (H00025953-P01) (0)

There are no publications for PNKD Recombinant Protein (H00025953-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNKD Recombinant Protein (H00025953-P01) (0)

There are no reviews for PNKD Recombinant Protein (H00025953-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNKD Recombinant Protein (H00025953-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PNKD Products

Bioinformatics Tool for PNKD Recombinant Protein (H00025953-P01)

Discover related pathways, diseases and genes to PNKD Recombinant Protein (H00025953-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNKD Recombinant Protein (H00025953-P01)

Discover more about diseases related to PNKD Recombinant Protein (H00025953-P01).
 

Pathways for PNKD Recombinant Protein (H00025953-P01)

View related products by pathway.

PTMs for PNKD Recombinant Protein (H00025953-P01)

Learn more about PTMs related to PNKD Recombinant Protein (H00025953-P01).

Blogs on PNKD

There are no specific blogs for PNKD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PNKD Antibody
NBP1-88347

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PNKD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PNKD