PMS2 Antibody


Western Blot: PMS2 Antibody [NBP1-58274] - HeLa extract Dilution: 1:1000.
Western Blot: PMS2 Antibody [NBP1-58274] - HepG2 cell lysate, 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related PMS2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PMS2 Antibody Summary

Synthetic peptides corresponding to PMS2(PMS2 postmeiotic segregation increased 2 (S. cerevisiae)) The peptide sequence was selected from the middle region of PMS2. Peptide sequence INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against PMS2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PMS2 Antibody

  • DNA mismatch repair protein PMS2
  • EC 3.1
  • H_DJ0042M02.9
  • HNPCC4postmeiotic segregation increased (S. cerevisiae) 2
  • mismatch repair endonuclease PMS2
  • PMS1 protein homolog 2
  • PMS2 postmeiotic segregation increased 2 (S. cerevisiae)


PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.This gene is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB

Publications for PMS2 Antibody (NBP1-58274) (0)

There are no publications for PMS2 Antibody (NBP1-58274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMS2 Antibody (NBP1-58274) (0)

There are no reviews for PMS2 Antibody (NBP1-58274). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMS2 Antibody (NBP1-58274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PMS2 Antibody Products

Related Products by Gene

Bioinformatics Tool for PMS2 Antibody (NBP1-58274)

Discover related pathways, diseases and genes to PMS2 Antibody (NBP1-58274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMS2 Antibody (NBP1-58274)

Discover more about diseases related to PMS2 Antibody (NBP1-58274).

Pathways for PMS2 Antibody (NBP1-58274)

View related products by pathway.

PTMs for PMS2 Antibody (NBP1-58274)

Learn more about PTMs related to PMS2 Antibody (NBP1-58274).

Research Areas for PMS2 Antibody (NBP1-58274)

Find related products by research area.

Blogs on PMS2

There are no specific blogs for PMS2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PMS2 Antibody and receive a gift card or discount.


Gene Symbol PMS2