PMP34 Antibody

Images

 
Immunohistochemistry: PMP34 Antibody [NBP2-30684] - Staining of human smooth muscle shows strong cytoplasmic and membranous positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMP34 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PMP34 Protein (NBP2-30684PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMP34 Antibody

  • 34 kDa peroxisomal membrane protein
  • 34kD), member 17
  • 34kDa), member 17
  • peroxisomal membrane protein (34kD)
  • peroxisomal membrane protein PMP34
  • PMP34Solute carrier family 25 member 17
  • solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15131
Species: Hu
Applications: WB
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59840
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-48030
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004498-R01
Species: Hu
NBP2-30684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PMP34 Antibody (NBP2-30684) (0)

There are no publications for PMP34 Antibody (NBP2-30684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMP34 Antibody (NBP2-30684) (0)

There are no reviews for PMP34 Antibody (NBP2-30684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PMP34 Antibody (NBP2-30684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMP34 Products

Bioinformatics Tool for PMP34 Antibody (NBP2-30684)

Discover related pathways, diseases and genes to PMP34 Antibody (NBP2-30684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP34 Antibody (NBP2-30684)

Discover more about diseases related to PMP34 Antibody (NBP2-30684).
 

Pathways for PMP34 Antibody (NBP2-30684)

View related products by pathway.

PTMs for PMP34 Antibody (NBP2-30684)

Learn more about PTMs related to PMP34 Antibody (NBP2-30684).

Blogs on PMP34

There are no specific blogs for PMP34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMP34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A17
Uniprot