PML Protein Antibody (1D12) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PML Protein Primary Antibodies

Order Details


    • Catalog Number
      H00005371-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PML Protein Antibody (1D12) [PerCP] Summary

Immunogen
PML (AAH00080 411 a.a. - 510 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Specificity
PML (1D12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PML
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PML Protein Antibody (1D12) [PerCP]

  • MYLPP8675
  • Promyelocytic leukemia protein
  • promyelocytic leukemia
  • RING finger protein 71
  • RNF71probable transcription factor PML
  • TRIM19promyelocytic leukemia, inducer of
  • tripartite motif protein TRIM19
  • Tripartite motif-containing protein 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-13809
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF755
Species: Mu
Applications: WB, Block
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005371-M02PCP
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, PLA

Publications for PML Protein Antibody (H00005371-M02PCP) (0)

There are no publications for PML Protein Antibody (H00005371-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PML Protein Antibody (H00005371-M02PCP) (0)

There are no reviews for PML Protein Antibody (H00005371-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PML Protein Antibody (H00005371-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PML Protein Products

Bioinformatics Tool for PML Protein Antibody (H00005371-M02PCP)

Discover related pathways, diseases and genes to PML Protein Antibody (H00005371-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PML Protein Antibody (H00005371-M02PCP)

Discover more about diseases related to PML Protein Antibody (H00005371-M02PCP).
 

Pathways for PML Protein Antibody (H00005371-M02PCP)

View related products by pathway.

PTMs for PML Protein Antibody (H00005371-M02PCP)

Learn more about PTMs related to PML Protein Antibody (H00005371-M02PCP).
 

Research Areas for PML Protein Antibody (H00005371-M02PCP)

Find related products by research area.

Blogs on PML Protein

There are no specific blogs for PML Protein, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PML Protein Antibody (1D12) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PML