PML Protein Antibody (1D12)

Images

 
Western Blot: PML Protein Antibody (1D12) [H00005371-M02] - PML monoclonal antibody (M02), clone 1D12. Analysis of PML expression in PC-12.
Immunocytochemistry/ Immunofluorescence: PML Protein Antibody (1D12) [H00005371-M02] - Analysis of monoclonal antibody to PML on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PML Protein Antibody (1D12) [H00005371-M02] - PML monoclonal antibody (M02), clone 1D12 Analysis of PML expression in Hela S3 NE.
Proximity Ligation Assay: PML Protein Antibody (1D12) [H00005371-M02] - Analysis of protein-protein interactions between TP53 and PML. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: PML Protein Antibody (1D12) [H00005371-M02] - Detection limit for recombinant GST tagged PML is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PML Protein Antibody (1D12) Summary

Immunogen
PML (AAH00080 411 a.a. - 510 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Specificity
PML (1D12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PML
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PML Protein Antibody (1D12)

  • MYLPP8675
  • Promyelocytic leukemia protein
  • promyelocytic leukemia
  • RING finger protein 71
  • RNF71probable transcription factor PML
  • TRIM19promyelocytic leukemia, inducer of
  • tripartite motif protein TRIM19
  • Tripartite motif-containing protein 19

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-13809
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF755
Species: Mu
Applications: WB, Block
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005371-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, PLA

Publications for PML Protein Antibody (H00005371-M02) (0)

There are no publications for PML Protein Antibody (H00005371-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PML Protein Antibody (H00005371-M02) (0)

There are no reviews for PML Protein Antibody (H00005371-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PML Protein Antibody (H00005371-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PML Protein Products

Bioinformatics Tool for PML Protein Antibody (H00005371-M02)

Discover related pathways, diseases and genes to PML Protein Antibody (H00005371-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PML Protein Antibody (H00005371-M02)

Discover more about diseases related to PML Protein Antibody (H00005371-M02).
 

Pathways for PML Protein Antibody (H00005371-M02)

View related products by pathway.

PTMs for PML Protein Antibody (H00005371-M02)

Learn more about PTMs related to PML Protein Antibody (H00005371-M02).
 

Research Areas for PML Protein Antibody (H00005371-M02)

Find related products by research area.

Blogs on PML Protein

There are no specific blogs for PML Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PML Protein Antibody (1D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PML
Entrez
OMIM
Uniprot