PLSCR2 Antibody

Images

 
Immunohistochemistry-Paraffin: PLSCR2 Antibody [NBP2-13779] Staining of human liver shows strong cytoplasmic positivity in hepatocytes. Bile duct cells were negative.

Product Details

Summary
Product Discontinued
View other related PLSCR2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-13779
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PLSCR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYL VPPAGTAGIPVQNQPGRPEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLSCR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLSCR2 Antibody

  • phospholipid scramblase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32588
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52866
Species: Hu, Mu
Applications: WB
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1341-WF/CF
Species: Hu
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF7109
Species: Mu
Applications: WB, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-90592
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13779
Species: Hu
Applications: IHC, IHC-P

Publications for PLSCR2 Antibody (NBP2-13779) (0)

There are no publications for PLSCR2 Antibody (NBP2-13779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLSCR2 Antibody (NBP2-13779) (0)

There are no reviews for PLSCR2 Antibody (NBP2-13779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLSCR2 Antibody (NBP2-13779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLSCR2 Products

PLSCR2 NBP2-13779

Bioinformatics Tool for PLSCR2 Antibody (NBP2-13779)

Discover related pathways, diseases and genes to PLSCR2 Antibody (NBP2-13779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLSCR2 Antibody (NBP2-13779)

Discover more about diseases related to PLSCR2 Antibody (NBP2-13779).
 

Pathways for PLSCR2 Antibody (NBP2-13779)

View related products by pathway.

PTMs for PLSCR2 Antibody (NBP2-13779)

Learn more about PTMs related to PLSCR2 Antibody (NBP2-13779).

Blogs on PLSCR2

There are no specific blogs for PLSCR2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLSCR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLSCR2