PLOD1 Antibody

Images

 
Western Blot: PLOD1 Antibody [NBP2-85500] - Host: Rabbit. Target Name: PLOD1. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

PLOD1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human PLOD1. Peptide sequence: DLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNC The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PLOD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PLOD1 Antibody

  • 2-oxoglutarate 5-dioxygenase 1
  • EC 1.14.11.4
  • Ehlers-Danlos syndrome type VI)
  • FLJ42041
  • LH1
  • LLH
  • lysine hydroxylase
  • Lysyl hydroxylase 1
  • PLODLH
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
  • procollagen-lysine
  • procollagen-lysine, 2-oxoglutarate 5-dioxygenase

Background

Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLOD1 Antibody (NBP2-85500) (0)

There are no publications for PLOD1 Antibody (NBP2-85500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLOD1 Antibody (NBP2-85500) (0)

There are no reviews for PLOD1 Antibody (NBP2-85500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLOD1 Antibody (NBP2-85500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLOD1 Products

Array NBP2-85500

Research Areas for PLOD1 Antibody (NBP2-85500)

Find related products by research area.

Blogs on PLOD1

There are no specific blogs for PLOD1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLOD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLOD1