PLGF Antibody

Images

 
Western Blot: PlGF Antibody [H00005228-B01P] - Analysis of PGF expression in transfected 293T cell line by PGF polyclonal antibody. Lane 1: PGF transfected lysate(18.7 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: PlGF Antibody [H00005228-B01P] - Analysis of purified antibody to PGF on formalin-fixed paraffin-embedded human uterine cervix. (antibody concentration 3 ug/ml)
Western Blot: PlGF Antibody [H00005228-B01P] - analysis of PGF expression in transfected 293T cell line by PGF MaxPab polyclonal antibody. Lane 1: PGF transfected lysate (18.7 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLGF Antibody Summary

Immunogen
PGF (NP_002623.2, 1 a.a. - 170 a.a.) full-length human protein. MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Specificity
PGF - placental growth factor, vascular endothelial growth factor-related protein,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PGF
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLGF Antibody

  • D12S1900
  • PGF
  • PGFL
  • placenta growth factor
  • placental growth factor
  • placental growth factor, vascular endothelial growth factor-related protein
  • PlGF
  • PlGF-2
  • PLGFplacental growth factor-like
  • SHGC-10760

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-69261
Species: Hu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005228-B01P
Species: Hu
Applications: WB, IHC-P

Publications for PLGF Antibody (H00005228-B01P) (0)

There are no publications for PLGF Antibody (H00005228-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLGF Antibody (H00005228-B01P) (0)

There are no reviews for PLGF Antibody (H00005228-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLGF Antibody (H00005228-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLGF Products

Bioinformatics Tool for PLGF Antibody (H00005228-B01P)

Discover related pathways, diseases and genes to PLGF Antibody (H00005228-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLGF Antibody (H00005228-B01P)

Discover more about diseases related to PLGF Antibody (H00005228-B01P).
 

Pathways for PLGF Antibody (H00005228-B01P)

View related products by pathway.

PTMs for PLGF Antibody (H00005228-B01P)

Learn more about PTMs related to PLGF Antibody (H00005228-B01P).
 

Research Areas for PLGF Antibody (H00005228-B01P)

Find related products by research area.

Blogs on PLGF

There are no specific blogs for PLGF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLGF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGF
Entrez
Uniprot