Recombinant Human Plexin B2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Plexin B2 Peptides and Proteins

Order Details


    • Catalog Number
      H00023654-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Plexin B2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1506-1611 of Human PLXNB2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVGVSQQPE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLXNB2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Plexin B2 Protein

  • MM1
  • MM1KIAA0315dJ402G11.3
  • Nbla00445
  • PLEXB2
  • Plexin B2
  • plexin-B2
  • PLXNB2

Background

PLXNB2 - plexin B2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF3749
Species: Hu
Applications: WB, IHC
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82806
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
AF6879
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF6120
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00023654-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Plexin B2 Partial Recombinant Protein (H00023654-Q01) (0)

There are no publications for Plexin B2 Partial Recombinant Protein (H00023654-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin B2 Partial Recombinant Protein (H00023654-Q01) (0)

There are no reviews for Plexin B2 Partial Recombinant Protein (H00023654-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plexin B2 Partial Recombinant Protein (H00023654-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plexin B2 Products

Bioinformatics Tool for Plexin B2 Partial Recombinant Protein (H00023654-Q01)

Discover related pathways, diseases and genes to Plexin B2 Partial Recombinant Protein (H00023654-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plexin B2 Partial Recombinant Protein (H00023654-Q01)

Discover more about diseases related to Plexin B2 Partial Recombinant Protein (H00023654-Q01).
 

Pathways for Plexin B2 Partial Recombinant Protein (H00023654-Q01)

View related products by pathway.

Research Areas for Plexin B2 Partial Recombinant Protein (H00023654-Q01)

Find related products by research area.

Blogs on Plexin B2

There are no specific blogs for Plexin B2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Plexin B2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLXNB2
Entrez