PLEKHG3 Antibody

Images

 
Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human liver.
Immunohistochemistry: PLEKHG3 Antibody [NBP2-68986] - Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human cerebral cortex, colon, kidney and liver using Anti-PLEKHG3 antibody NBP2-68986 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human kidney.
Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PLEKHG3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHG3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PLEKHG3 Antibody

  • ARHGEF43
  • KIAA0599
  • PH Domain-Containing Family G Member 3
  • Pleckstrin Homology And RhoGEF Domain Containing G3
  • Pleckstrin Homology Domain Containing, Family G, Member 3
  • Pleckstrin Homology Domain-Containing Family G Member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-574
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP1-94125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP2-68986
Species: Hu
Applications: IHC, IHC-P

Publications for PLEKHG3 Antibody (NBP2-68986) (0)

There are no publications for PLEKHG3 Antibody (NBP2-68986).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHG3 Antibody (NBP2-68986) (0)

There are no reviews for PLEKHG3 Antibody (NBP2-68986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLEKHG3 Antibody (NBP2-68986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHG3 Products

Bioinformatics Tool for PLEKHG3 Antibody (NBP2-68986)

Discover related pathways, diseases and genes to PLEKHG3 Antibody (NBP2-68986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHG3 Antibody (NBP2-68986)

Discover more about diseases related to PLEKHG3 Antibody (NBP2-68986).

Blogs on PLEKHG3

There are no specific blogs for PLEKHG3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHG3