Recombinant Human Pleiotrophin/PTN Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Pleiotrophin/PTN Peptides and Proteins

Order Details


    • Catalog Number
      H00005764-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Pleiotrophin/PTN Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 45-154 of Human PTN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTN

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pleiotrophin/PTN Protein

  • HARP
  • HBBM
  • HB-GAM
  • HBGF8
  • HBNF
  • HBNF1
  • HBNF-1
  • Heparin-binding brain mitogen
  • HNGF-8
  • NEGF1HBGF-8
  • neurite growth-promoting factor 1
  • neurite growth-promoting factor1)
  • OSF-1
  • Osteoblast-specific factor 1
  • Pleiotrophin
  • PTN

Background

PTN - pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
MAB2688
Species: Hu
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
AF3697
Species: Hu
Applications: WB
AF2734
Species: Mu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
232-FA/CF
Species: Hu
AF2200
Species: Hu
Applications: WB, IP

Publications for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01) (0)

There are no publications for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01) (0)

There are no reviews for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pleiotrophin/PTN Products

Bioinformatics Tool for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01)

Discover related pathways, diseases and genes to Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01)

Discover more about diseases related to Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01).
 

Pathways for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01)

View related products by pathway.

PTMs for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01)

Learn more about PTMs related to Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01).
 

Research Areas for Pleiotrophin/PTN Partial Recombinant Protein (H00005764-Q01)

Find related products by research area.

Blogs on Pleiotrophin/PTN

There are no specific blogs for Pleiotrophin/PTN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pleiotrophin/PTN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTN
Entrez