PLCL2 Antibody


Immunohistochemistry-Paraffin: PLCL2 Antibody [NBP2-13768] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PLCL2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSK IELKFKELHKSKDKAGTEVTKEEFIE
Specificity of human PLCL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLCL2 Antibody

  • EC
  • FLJ13484
  • inactive phospholipase C-like protein 2
  • KIAA1092PLCE2
  • phospholipase C, epsilon 2
  • Phospholipase C-epsilon-2
  • Phospholipase C-L2
  • phospholipase C-like 2
  • PLC-epsilon-2
  • PLC-L(2)
  • PLC-L2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ha, Pm, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, AgAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
Species: Hu, Mu, Rt, Tr, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PLCL2 Antibody (NBP2-13768) (0)

There are no publications for PLCL2 Antibody (NBP2-13768).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCL2 Antibody (NBP2-13768) (0)

There are no reviews for PLCL2 Antibody (NBP2-13768). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLCL2 Antibody (NBP2-13768) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLCL2 Products

Bioinformatics Tool for PLCL2 Antibody (NBP2-13768)

Discover related pathways, diseases and genes to PLCL2 Antibody (NBP2-13768). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLCL2 Antibody (NBP2-13768)

Discover more about diseases related to PLCL2 Antibody (NBP2-13768).

Pathways for PLCL2 Antibody (NBP2-13768)

View related products by pathway.

Blogs on PLCL2

There are no specific blogs for PLCL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLCL2 Antibody and receive a gift card or discount.


Gene Symbol PLCL2