PLC-gamma 1 Antibody (2A2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PLC-gamma 1 Primary Antibodies

Order Details


    • Catalog Number
      H00005335-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PLC-gamma 1 Antibody (2A2) [DyLight 488] Summary

Immunogen
PLCG1 (NP_002651 1192 a.a. - 1291 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Localization
Cytoplasmic
Specificity
PLCG1 - phospholipase C, gamma 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLCG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLC-gamma 1 Antibody (2A2) [DyLight 488]

  • EC 3.1.4.11
  • gamma 1 (formerly subtype 148)
  • monophosphatidylinositol phosphodiesterase
  • NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
  • phosphatidylinositol phospholipase C
  • phosphoinositidase C
  • phosphoinositide phospholipase C
  • Phosphoinositide phospholipase C-gamma-1
  • phospholipase C, gamma 1
  • phospholipase C-148
  • Phospholipase C-gamma-1
  • Phospholipase C-II
  • PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
  • PLC148
  • PLC-148
  • PLCG1
  • PLCgamma 1
  • PLC-gamma 1
  • PLC-gamma-1
  • PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate
  • PPLCA
  • triphosphoinositide phosphodiesterase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4466
Species: Hu, Mu
Applications: WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5128
Species: Hu, Mu, Rt
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00089869-R01
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF5866
Species: Hu
Applications: WB, IHC
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005335-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA

Publications for PLC-gamma 1 Antibody (H00005335-M01G) (0)

There are no publications for PLC-gamma 1 Antibody (H00005335-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-gamma 1 Antibody (H00005335-M01G) (0)

There are no reviews for PLC-gamma 1 Antibody (H00005335-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLC-gamma 1 Antibody (H00005335-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLC-gamma 1 Products

Bioinformatics Tool for PLC-gamma 1 Antibody (H00005335-M01G)

Discover related pathways, diseases and genes to PLC-gamma 1 Antibody (H00005335-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLC-gamma 1 Antibody (H00005335-M01G)

Discover more about diseases related to PLC-gamma 1 Antibody (H00005335-M01G).
 

Pathways for PLC-gamma 1 Antibody (H00005335-M01G)

View related products by pathway.

PTMs for PLC-gamma 1 Antibody (H00005335-M01G)

Learn more about PTMs related to PLC-gamma 1 Antibody (H00005335-M01G).
 

Research Areas for PLC-gamma 1 Antibody (H00005335-M01G)

Find related products by research area.

Blogs on PLC-gamma 1

There are no specific blogs for PLC-gamma 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLC-gamma 1 Antibody (2A2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCG1
Entrez