PLC-beta 1 Antibody

Images

 
Western Blot: PLC-beta 1 Antibody [NBP1-58257] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLC-beta 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PLCB1(phospholipase C, beta 1 (phosphoinositide-specific)) The peptide sequence was selected from the middle region of PLCB1. Peptide sequence EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Rabbit (93%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PLCB1 and was validated on Western blot.
Theoretical MW
134 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLC-beta 1 Antibody

  • EC 3.1.4.11
  • EIEE12
  • FLJ45792
  • inositoltrisphosphohydrolase
  • KIAA05811-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1
  • monophosphatidylinositol phosphodiesterase
  • phosphoinositidase C
  • Phosphoinositide phospholipase C-beta-1
  • phospholipase C, beta 1 (phosphoinositide-specific)
  • Phospholipase C-beta-1
  • Phospholipase C-I
  • PI-PLC
  • PLC-154
  • PLC154,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1
  • PLCB1
  • PLCB1A
  • PLCB1B
  • PLCbeta 1
  • PLC-beta 1
  • PLC-beta-1
  • PLC-I
  • PLC-I1-phosphatidyl-D-myo-inositol-4,5-bisphosphate
  • triphosphoinositide phosphodiesterase

Background

The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52533
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF2364
Species: Hu
Applications: WB, IHC
NBP2-02541
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31974
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93485
Species: Hu, Mu, Rt
Applications: WB
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-58257
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for PLC-beta 1 Antibody (NBP1-58257) (0)

There are no publications for PLC-beta 1 Antibody (NBP1-58257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-beta 1 Antibody (NBP1-58257) (0)

There are no reviews for PLC-beta 1 Antibody (NBP1-58257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLC-beta 1 Antibody (NBP1-58257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLC-beta 1 Products

Bioinformatics Tool for PLC-beta 1 Antibody (NBP1-58257)

Discover related pathways, diseases and genes to PLC-beta 1 Antibody (NBP1-58257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLC-beta 1 Antibody (NBP1-58257)

Discover more about diseases related to PLC-beta 1 Antibody (NBP1-58257).
 

Pathways for PLC-beta 1 Antibody (NBP1-58257)

View related products by pathway.

PTMs for PLC-beta 1 Antibody (NBP1-58257)

Learn more about PTMs related to PLC-beta 1 Antibody (NBP1-58257).
 

Research Areas for PLC-beta 1 Antibody (NBP1-58257)

Find related products by research area.

Blogs on PLC-beta 1

There are no specific blogs for PLC-beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLC-beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCB1
Uniprot