Plasminogen Antibody (2A10)

Images

 
Sandwich ELISA: Plasminogen Antibody (2A10) [H00005340-M01] - Detection limit for recombinant GST tagged PLG is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Plasminogen Antibody (2A10) Summary

Immunogen
PLG (AAH60513, 21 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
Specificity
PLG - plasminogen
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00005340-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Plasminogen Antibody (2A10)

  • DKFZp779M0222
  • EC 3.4.21
  • EC 3.4.21.7
  • plasmin
  • Plasminogen
  • Plg

Background

Plasminogen (PLG) is a circulating zymogen that is converted to the active enzyme plasmin by cleavage of the peptide bond between arg560 and val561, which is mediated by urokinase (PLAU; MIM 191840) and tissue plasminogen activator (TPA, PLAT; MIM 173370). The main function of plasmin is to dissolve fibrin (see, e.g., FGA, MIM 134820) clots. Plasmin, like trypsin, belongs to the family of serine proteinases (Miyata et al., 1982 [PubMed 6216475]; Forsgren et al., 1987 [PubMed 3030813]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-07799
Species: Hu
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005340-M01
Species: Hu
Applications: WB, ELISA

Publications for Plasminogen Antibody (H00005340-M01)(1)

Reviews for Plasminogen Antibody (H00005340-M01) (0)

There are no reviews for Plasminogen Antibody (H00005340-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plasminogen Antibody (H00005340-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plasminogen Products

Bioinformatics Tool for Plasminogen Antibody (H00005340-M01)

Discover related pathways, diseases and genes to Plasminogen Antibody (H00005340-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plasminogen Antibody (H00005340-M01)

Discover more about diseases related to Plasminogen Antibody (H00005340-M01).
 

Pathways for Plasminogen Antibody (H00005340-M01)

View related products by pathway.

PTMs for Plasminogen Antibody (H00005340-M01)

Learn more about PTMs related to Plasminogen Antibody (H00005340-M01).
 

Research Areas for Plasminogen Antibody (H00005340-M01)

Find related products by research area.

Blogs on Plasminogen

There are no specific blogs for Plasminogen, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plasminogen Antibody (2A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLG
Entrez
OMIM
Uniprot