Recombinant Human Placental Lactogen/CSH1 Protein



Product Details

Product Discontinued
View other related Placental Lactogen/CSH1 Peptides and Proteins

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Placental Lactogen/CSH1 Protein Summary

A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-100 of Human CSH1 partial ORF

Source: Wheat Germ (in vitro)


Protein/Peptide Type
Partial Recombinant Protein


Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. This protein is not active and should not be used for experiments requiring activity.

Reactivity Notes


Packaging, Storage & Formulations

Store at -80C. Avoid freeze-thaw cycles.
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Placental Lactogen/CSH1 Protein

  • Choriomammotropin
  • chorionic somatomammotropin hormone 1 (placental lactogen)
  • chorionic somatomammotropin hormone
  • CS-1
  • CSAchorionic somatomammotropin A
  • CSH1
  • CSH2
  • CSMT
  • FLJ75407
  • hCS-A
  • Lactogen
  • PL
  • Placental Lactogen
  • PLchoriomammotropin


CSH1 - chorionic somatomammotropin hormone 1 (placental lactogen)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01) (0)

There are no publications for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01) (0)

There are no reviews for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in this product - hPL peptide. I wanna know its size, position, and the evidence that it could mimic the whole protein. Do you know whether there is a fragment of human placental lactogen would bind to its receptor?
    • Human CSH1 partial ORF ( NP_001308, 118 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. FLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF. From the data I am showing on this partial recombinant protein it has never been tested for any sort of functional binding assay so we can not guarantee one way or the other if this protein fragment would bind to the receptor. Please keep in mind that this recombinant protein is synthesized in a cell free wheat germ system. This system is unique to the Taiwanese company that produces it and in some cases the proteins do not fold the same as an endogenous protein since they do not undergo the same post translational modifications.

Additional Placental Lactogen/CSH1 Products

Bioinformatics Tool for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01)

Discover related pathways, diseases and genes to Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01)

Discover more about diseases related to Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01).

Pathways for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01)

View related products by pathway.

PTMs for Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01)

Learn more about PTMs related to Placental Lactogen/CSH1 Partial Recombinant Protein (H00001442-Q01).

Blogs on Placental Lactogen/CSH1

There are no specific blogs for Placental Lactogen/CSH1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Recombinant Human Placental Lactogen/CSH1 Protein and receive a gift card or discount.


Gene Symbol CSH1