PKNOX1 Antibody (2A12) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PKNOX1 Primary Antibodies

Order Details


    • Catalog Number
      H00005316-M07PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PKNOX1 Antibody (2A12) [PerCP] Summary

Immunogen
PKNOX1 (NP_004562, 2 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ
Specificity
PKNOX1 (2A12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKNOX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKNOX1 Antibody (2A12) [PerCP]

  • Homeobox protein PREP-1
  • PBX/kn10Pbx regulating protein-1
  • pkonx1c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-31853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81728
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00063876-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
AF6318
Species: Hu
Applications: ICC
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-13734
Species: Hu
Applications: IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005316-M07PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PKNOX1 Antibody (H00005316-M07PCP) (0)

There are no publications for PKNOX1 Antibody (H00005316-M07PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKNOX1 Antibody (H00005316-M07PCP) (0)

There are no reviews for PKNOX1 Antibody (H00005316-M07PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKNOX1 Antibody (H00005316-M07PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKNOX1 Products

Bioinformatics Tool for PKNOX1 Antibody (H00005316-M07PCP)

Discover related pathways, diseases and genes to PKNOX1 Antibody (H00005316-M07PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKNOX1 Antibody (H00005316-M07PCP)

Discover more about diseases related to PKNOX1 Antibody (H00005316-M07PCP).
 

Pathways for PKNOX1 Antibody (H00005316-M07PCP)

View related products by pathway.

PTMs for PKNOX1 Antibody (H00005316-M07PCP)

Learn more about PTMs related to PKNOX1 Antibody (H00005316-M07PCP).

Blogs on PKNOX1

There are no specific blogs for PKNOX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKNOX1 Antibody (2A12) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PKNOX1