PKN2 Antibody (3A7) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related PKN2 Primary Antibodies

Order Details


    • Catalog Number
      H00005586-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PKN2 Antibody (3A7) [DyLight 755] Summary

Immunogen
PKN2 (NP_006247 580 a.a. - 679 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT
Specificity
PKN2 - protein kinase N2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKN2 Antibody (3A7) [DyLight 755]

  • cardiolipin-activated protein kinase Pak2
  • EC 2.7.11
  • EC 2.7.11.13
  • PAK2
  • Pak-2
  • PKN2
  • PRK2
  • PRK2MGC150606
  • PRKCL2
  • PRKCL2PRO2042
  • PRO2042
  • Protein kinase C-like 2MGC71074
  • protein kinase N2
  • Protein-kinase C-related kinase 2
  • serine/threonine-protein kinase N2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005058-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-91266
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-2901
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for PKN2 Antibody (H00005586-M01IR) (0)

There are no publications for PKN2 Antibody (H00005586-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKN2 Antibody (H00005586-M01IR) (0)

There are no reviews for PKN2 Antibody (H00005586-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKN2 Antibody (H00005586-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKN2 Antibody (3A7) [DyLight 755] Products

Related Products by Gene

Bioinformatics Tool for PKN2 Antibody (H00005586-M01IR)

Discover related pathways, diseases and genes to PKN2 Antibody (H00005586-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKN2 Antibody (H00005586-M01IR)

Discover more about diseases related to PKN2 Antibody (H00005586-M01IR).
 

Pathways for PKN2 Antibody (H00005586-M01IR)

View related products by pathway.

PTMs for PKN2 Antibody (H00005586-M01IR)

Learn more about PTMs related to PKN2 Antibody (H00005586-M01IR).
 

Research Areas for PKN2 Antibody (H00005586-M01IR)

Find related products by research area.

Blogs on PKN2

There are no specific blogs for PKN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKN2 Antibody (3A7) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol PKN2
Entrez