PKN2 Antibody (3A7) [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related PKN2 Primary Antibodies

Order Details


    • Catalog Number
      H00005586-M01AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PKN2 Antibody (3A7) [Alexa Fluor® 700] Summary

Immunogen
PKN2 (NP_006247, 580 a.a. ~ 679 a.a) partial recombinant protein with GST tag.RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQ SEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVL GRGHFGKVLLAEYKNT
Specificity
PKN2 - protein kinase N2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
Alexa Fluor 700
Format
Alexa Fluor 700 (A=675-700, E=723)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for PKN2 Antibody (3A7) [Alexa Fluor® 700]

  • cardiolipin-activated protein kinase Pak2
  • EC 2.7.11
  • EC 2.7.11.13
  • PAK2
  • Pak-2
  • PKN2
  • PRK2
  • PRK2MGC150606
  • PRKCL2
  • PRKCL2PRO2042
  • PRO2042
  • Protein kinase C-like 2MGC71074
  • protein kinase N2
  • Protein-kinase C-related kinase 2
  • serine/threonine-protein kinase N2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6100
Species: Hu, Mu
Applications: WB
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
H00005058-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-45477
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
NBP1-88650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
MAB1776
Species: Hu, Mu, Rt
Applications: WB
MAB2685
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-2901
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84168
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005586-M01AF700
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PKN2 Antibody (H00005586-M01AF700) (0)

There are no publications for PKN2 Antibody (H00005586-M01AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKN2 Antibody (H00005586-M01AF700) (0)

There are no reviews for PKN2 Antibody (H00005586-M01AF700). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKN2 Antibody (H00005586-M01AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKN2 Products

Related Products by Gene

Bioinformatics Tool for PKN2 Antibody (H00005586-M01AF700)

Discover related pathways, diseases and genes to PKN2 Antibody (H00005586-M01AF700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKN2 Antibody (H00005586-M01AF700)

Discover more about diseases related to PKN2 Antibody (H00005586-M01AF700).
 

Pathways for PKN2 Antibody (H00005586-M01AF700)

View related products by pathway.

PTMs for PKN2 Antibody (H00005586-M01AF700)

Learn more about PTMs related to PKN2 Antibody (H00005586-M01AF700).
 

Research Areas for PKN2 Antibody (H00005586-M01AF700)

Find related products by research area.

Blogs on PKN2

There are no specific blogs for PKN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PKN2
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00005586-M01AF700 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.