PKLR Antibody (3B11)

Images

 
There are currently no images for PKLR Antibody (H00005313-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKLR Antibody (3B11) Summary

Immunogen
PKLR (AAH25737 485 a.a. - 574 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
Specificity
PKLR - pyruvate kinase, liver and RBC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKLR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKLR Antibody (3B11)

  • EC 2.7.1.40
  • PK1
  • PK1PKRL
  • PKL
  • PKLR
  • PKR
  • Pyruvate Kinase 1
  • pyruvate kinase isozyme R/L
  • pyruvate kinase isozymes R/L
  • pyruvate kinase type L
  • pyruvate kinase, liver and blood cell
  • pyruvate kinase, liver and RBC
  • Red cell/liver pyruvate kinase
  • RPK
  • R-type/L-type pyruvate kinase

Background

The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-43853
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
H00005313-M01
Species: Hu
Applications: ELISA

Publications for PKLR Antibody (H00005313-M01) (0)

There are no publications for PKLR Antibody (H00005313-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKLR Antibody (H00005313-M01) (0)

There are no reviews for PKLR Antibody (H00005313-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PKLR Antibody (H00005313-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKLR Products

Bioinformatics Tool for PKLR Antibody (H00005313-M01)

Discover related pathways, diseases and genes to PKLR Antibody (H00005313-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKLR Antibody (H00005313-M01)

Discover more about diseases related to PKLR Antibody (H00005313-M01).
 

Pathways for PKLR Antibody (H00005313-M01)

View related products by pathway.

PTMs for PKLR Antibody (H00005313-M01)

Learn more about PTMs related to PKLR Antibody (H00005313-M01).
 

Research Areas for PKLR Antibody (H00005313-M01)

Find related products by research area.

Blogs on PKLR

There are no specific blogs for PKLR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKLR Antibody (3B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PKLR
Entrez
OMIM
Uniprot