PKC delta Antibody (2E12.) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PKC delta Primary Antibodies

Order Details


    • Catalog Number
      H00005580-M06PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PKC delta Antibody (2E12.) [PerCP] Summary

Immunogen
PRKCD (NP_006245 577 a.a. - 676 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Localization
Cytoplasmic
Specificity
PRKCD - protein kinase C, delta
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKCD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKC delta Antibody (2E12.) [PerCP]

  • EC 2.7.11
  • EC 2.7.11.13
  • MAY1
  • MGC49908
  • nPKC-delta
  • PKC delta
  • PKCD
  • PRKCD
  • protein kinase C delta type
  • protein kinase C delta VIII
  • protein kinase C, delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
AF5134
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for PKC delta Antibody (H00005580-M06PCP) (0)

There are no publications for PKC delta Antibody (H00005580-M06PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC delta Antibody (H00005580-M06PCP) (0)

There are no reviews for PKC delta Antibody (H00005580-M06PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC delta Antibody (H00005580-M06PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKC delta Products

Bioinformatics Tool for PKC delta Antibody (H00005580-M06PCP)

Discover related pathways, diseases and genes to PKC delta Antibody (H00005580-M06PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC delta Antibody (H00005580-M06PCP)

Discover more about diseases related to PKC delta Antibody (H00005580-M06PCP).
 

Pathways for PKC delta Antibody (H00005580-M06PCP)

View related products by pathway.

PTMs for PKC delta Antibody (H00005580-M06PCP)

Learn more about PTMs related to PKC delta Antibody (H00005580-M06PCP).
 

Research Areas for PKC delta Antibody (H00005580-M06PCP)

Find related products by research area.

Blogs on PKC delta

There are no specific blogs for PKC delta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC delta Antibody (2E12.) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCD
Entrez