PKC alpha Antibody (2F11)

Images

 
Western Blot: PKC alpha Antibody (2F11) [H00005578-M01] - PRKCA monoclonal antibody (M01), clone 2F11 Analysis of PRKCA expression in HeLa.
Immunocytochemistry/ Immunofluorescence: PKC alpha Antibody (2F11) [H00005578-M01] - Analysis of monoclonal antibody to PRKCA on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PKC alpha Antibody (2F11) [H00005578-M01] - Analysis of monoclonal antibody to PRKCA on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.
Proximity Ligation Assay: PKC alpha Antibody (2F11) [H00005578-M01] - Analysis of protein-protein interactions between FAS and PRKCA. HeLa cells were stained with anti-FAS rabbit purified polyclonal 1:1200 and ...read more
ELISA: PKC alpha Antibody (2F11) [H00005578-M01] - Detection limit for recombinant GST tagged PRKCA is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKC alpha Antibody (2F11) Summary

Immunogen
PRKCA (NP_002728, 563 a.a. ~ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Localization
Cytoplasmic and Nuclear
Specificity
PRKCA - protein kinase C, alpha
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKCA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKC alpha Antibody (2F11)

  • AAG6
  • aging-associated gene 6
  • EC 2.7.11
  • EC 2.7.11.13
  • MGC129901
  • PKC alpha
  • PKCA
  • PKC-A
  • PKC-alpha
  • PKCAMGC129900
  • PRKACA
  • PRKCA
  • protein kinase C alpha type
  • protein kinase C, alpha

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-19846
Species: Hu, Rt, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87270
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67063
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67912
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-58916
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for PKC alpha Antibody (H00005578-M01) (0)

There are no publications for PKC alpha Antibody (H00005578-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC alpha Antibody (H00005578-M01) (0)

There are no reviews for PKC alpha Antibody (H00005578-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC alpha Antibody (H00005578-M01). (Showing 1 - 1 of 1 FAQ).

  1. We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.
    • We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PKC alpha Products

Bioinformatics Tool for PKC alpha Antibody (H00005578-M01)

Discover related pathways, diseases and genes to PKC alpha Antibody (H00005578-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC alpha Antibody (H00005578-M01)

Discover more about diseases related to PKC alpha Antibody (H00005578-M01).
 

Pathways for PKC alpha Antibody (H00005578-M01)

View related products by pathway.

PTMs for PKC alpha Antibody (H00005578-M01)

Learn more about PTMs related to PKC alpha Antibody (H00005578-M01).
 

Research Areas for PKC alpha Antibody (H00005578-M01)

Find related products by research area.

Blogs on PKC alpha.

There is nothing beta than PKC Alpha
cAMP-dependent protein kinase (PKA) is a Ser/Thr protein kinase that is highly conserved between species. Three distinct catalytic (C) subunits have been identified, designated C-alpha, C-beta and C-gamma, where C-alpha and C-beta are most closely rel...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC alpha Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCA
Entrez
OMIM
Uniprot