PIST Antibody


Western Blot: PIST Antibody [NBP1-55207] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related PIST Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PIST Antibody Summary

Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the middle region of GOPC. Peptide sequence RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GOPC and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIST Antibody

  • CALPDZ protein interacting specifically with TC10
  • CFTR-associated ligand
  • dJ94G16.2
  • FIGdJ94G16.2 PIST
  • Fused in glioblastoma
  • golgi-associated PDZ and coiled-coil motif containing
  • Golgi-associated PDZ and coiled-coil motif-containing protein
  • GOPC1
  • PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10
  • PISTGolgi associated PDZ and coiled-coil motif containing protein


GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Ye
Applications: WB
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB

Publications for PIST Antibody (NBP1-55207) (0)

There are no publications for PIST Antibody (NBP1-55207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIST Antibody (NBP1-55207) (0)

There are no reviews for PIST Antibody (NBP1-55207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIST Antibody (NBP1-55207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PIST Antibody (NBP1-55207)

Discover related pathways, diseases and genes to PIST Antibody (NBP1-55207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIST Antibody (NBP1-55207)

Discover more about diseases related to PIST Antibody (NBP1-55207).

Pathways for PIST Antibody (NBP1-55207)

View related products by pathway.

PTMs for PIST Antibody (NBP1-55207)

Learn more about PTMs related to PIST Antibody (NBP1-55207).

Blogs on PIST

There are no specific blogs for PIST, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIST Antibody and receive a gift card or discount.


Gene Symbol GOPC