Pirh2 Antibody

Images

 
Western Blot: Pirh2 Antibody [NBP1-53137] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Pirh2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53137
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Pirh2 Antibody Summary

Immunogen
Synthetic peptides corresponding to RCHY1(ring finger and CHY zinc finger domain containing 1) The peptide sequence was selected from the N terminal of RCHY1. Peptide sequence KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY.
Clonality
Polyclonal
Host
Rabbit
Gene
RCHY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RCHY1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pirh2 Antibody

  • Androgen receptor N-terminal-interacting protein
  • androgen-receptor N-terminal-interacting protein
  • ARNIPRING finger protein 199
  • CHIMPRNF199DKFZp586C1620
  • CH-rich interacting match with PLAG1
  • CH-rich-interacting match with PLAG1
  • E3 ubiquitin-protein ligase Pirh2
  • EC 6.3.2.-
  • hARNIP
  • hPirh2
  • PIRH2
  • PRO1996
  • ring finger and CHY zinc finger domain containing 1
  • RING finger and CHY zinc finger domain-containing protein 1
  • Zinc finger protein 363p53-induced RING-H2 protein
  • ZNF363

Background

RCHY1 has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53.The protein encoded by this gene has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF1555
Species: Hu
Applications: WB
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45912
Species: Hu
Applications: WB, IHC
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-53137
Species: Hu
Applications: WB

Publications for Pirh2 Antibody (NBP1-53137) (0)

There are no publications for Pirh2 Antibody (NBP1-53137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pirh2 Antibody (NBP1-53137) (0)

There are no reviews for Pirh2 Antibody (NBP1-53137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pirh2 Antibody (NBP1-53137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pirh2 Products

Bioinformatics Tool for Pirh2 Antibody (NBP1-53137)

Discover related pathways, diseases and genes to Pirh2 Antibody (NBP1-53137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pirh2 Antibody (NBP1-53137)

Discover more about diseases related to Pirh2 Antibody (NBP1-53137).
 

Pathways for Pirh2 Antibody (NBP1-53137)

View related products by pathway.

PTMs for Pirh2 Antibody (NBP1-53137)

Learn more about PTMs related to Pirh2 Antibody (NBP1-53137).
 

Research Areas for Pirh2 Antibody (NBP1-53137)

Find related products by research area.

Blogs on Pirh2

There are no specific blogs for Pirh2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pirh2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCHY1