PILR-alpha Antibody


Immunohistochemistry-Paraffin: PILR-alpha Antibody [NBP2-55310] - Immunohistochemical staining of human tonsil shows cytoplasmic positivity in both germinal and non-germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PILR-alpha Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALSSSTSPRAPPSHRPLKSPQNETLYSVLK
Specificity of human PILR-alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PILR-alpha Antibody

  • Cell surface receptor FDF03
  • FDF03
  • inhibitory receptor PILRalpha
  • Inhibitory receptor PILR-alpha
  • paired immunoglobin-like receptor alpha
  • paired immunoglobin-like type 2 receptor alpha
  • paired immunoglobulin-like receptor alpha
  • paired immunoglobulin-like type 2 receptor alpha
  • PILRalpha
  • PILR-alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for PILR-alpha Antibody (NBP2-55310) (0)

There are no publications for PILR-alpha Antibody (NBP2-55310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PILR-alpha Antibody (NBP2-55310) (0)

There are no reviews for PILR-alpha Antibody (NBP2-55310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PILR-alpha Antibody (NBP2-55310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PILR-alpha Products

Bioinformatics Tool for PILR-alpha Antibody (NBP2-55310)

Discover related pathways, diseases and genes to PILR-alpha Antibody (NBP2-55310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PILR-alpha Antibody (NBP2-55310)

Discover more about diseases related to PILR-alpha Antibody (NBP2-55310).

Pathways for PILR-alpha Antibody (NBP2-55310)

View related products by pathway.

PTMs for PILR-alpha Antibody (NBP2-55310)

Learn more about PTMs related to PILR-alpha Antibody (NBP2-55310).

Research Areas for PILR-alpha Antibody (NBP2-55310)

Find related products by research area.

Blogs on PILR-alpha

There are no specific blogs for PILR-alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PILR-alpha Antibody and receive a gift card or discount.


Gene Symbol PILRA