PIK3R4 Antibody (1B5) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related PIK3R4 Primary Antibodies

Order Details


    • Catalog Number
      H00030849-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PIK3R4 Antibody (1B5) [PE] Summary

Immunogen
PIK3R4 (NP_055417, 1259 a.a. ~ 1359 a.a) partial recombinant protein with GST tag.AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEV VQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQ GFIVTASRDGIVKVWK
Specificity
PIK3R4 - phosphoinositide-3-kinase, regulatory subunit 4, p150
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIK3R4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIK3R4 Antibody (1B5) [PE]

  • EC 2.7.11.1
  • MGC102700
  • p150
  • phosphatidylinositol 3-kinase-associated p150
  • Phosphoinositide 3-kinase adaptor protein
  • phosphoinositide 3-kinase regulatory subunit 4
  • phosphoinositide-3-kinase, regulatory subunit 4
  • phosphoinositide-3-kinase, regulatory subunit 4, p150
  • PI3-kinase p150 subunit
  • PI3-kinase regulatory subunit 4
  • PIK3R4
  • VPS 15
  • VPS15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
796-IC
Species: Mu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-43567
Species: Hu, Mu
Applications: WB
NBP1-88854
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
H00030849-M02PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PIK3R4 Antibody (H00030849-M02PE) (0)

There are no publications for PIK3R4 Antibody (H00030849-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R4 Antibody (H00030849-M02PE) (0)

There are no reviews for PIK3R4 Antibody (H00030849-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIK3R4 Antibody (H00030849-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIK3R4 Products

Bioinformatics Tool for PIK3R4 Antibody (H00030849-M02PE)

Discover related pathways, diseases and genes to PIK3R4 Antibody (H00030849-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3R4 Antibody (H00030849-M02PE)

Discover more about diseases related to PIK3R4 Antibody (H00030849-M02PE).
 

Pathways for PIK3R4 Antibody (H00030849-M02PE)

View related products by pathway.

PTMs for PIK3R4 Antibody (H00030849-M02PE)

Learn more about PTMs related to PIK3R4 Antibody (H00030849-M02PE).
 

Research Areas for PIK3R4 Antibody (H00030849-M02PE)

Find related products by research area.

Blogs on PIK3R4

There are no specific blogs for PIK3R4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIK3R4 Antibody (1B5) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R4
Entrez