PIK3R3 Antibody (2F8)

Images

 
Western Blot: PIK3R3 Antibody (2F8) [H00008503-M02] - PIK3R3 monoclonal antibody (M02), clone 2F8. Analysis of PIK3R3 expression in human spleen.
Proximity Ligation Assay: PIK3R3 Antibody (2F8) [H00008503-M02] - Analysis of protein-protein interactions between EGFR and PIK3R3. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: PIK3R3 Antibody (2F8) [H00008503-M02] - Detection limit for recombinant GST tagged PIK3R3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIK3R3 Antibody (2F8) Summary

Immunogen
PIK3R3 (AAH21622 271 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF
Specificity
PIK3R3 - phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma) (2F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIK3R3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIK3R3 Antibody (2F8)

  • 100% homology to SWISS-PROT Q92569
  • DKFZp686P05226
  • FLJ41892
  • p55
  • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  • phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
  • phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma)
  • phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma)
  • PI3K regulatory subunit gamma
  • PI3-kinase subunit p55-gamma
  • regulatory subunit, polypeptide 3 (p55, gamma)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008503-M02
Species: Hu
Applications: WB, ELISA, PLA

Publications for PIK3R3 Antibody (H00008503-M02) (0)

There are no publications for PIK3R3 Antibody (H00008503-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3R3 Antibody (H00008503-M02) (0)

There are no reviews for PIK3R3 Antibody (H00008503-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIK3R3 Antibody (H00008503-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIK3R3 Products

Bioinformatics Tool for PIK3R3 Antibody (H00008503-M02)

Discover related pathways, diseases and genes to PIK3R3 Antibody (H00008503-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3R3 Antibody (H00008503-M02)

Discover more about diseases related to PIK3R3 Antibody (H00008503-M02).
 

Pathways for PIK3R3 Antibody (H00008503-M02)

View related products by pathway.

PTMs for PIK3R3 Antibody (H00008503-M02)

Learn more about PTMs related to PIK3R3 Antibody (H00008503-M02).
 

Research Areas for PIK3R3 Antibody (H00008503-M02)

Find related products by research area.

Blogs on PIK3R3

There are no specific blogs for PIK3R3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIK3R3 Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R3
Entrez
Uniprot