PIGM Antibody

Images

 
Immunohistochemistry-Paraffin: PIGM Antibody [NBP2-13761] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGM Protein (NBP2-13761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGM Antibody

  • EC 2.4.1
  • EC 2.4.1.-
  • GPI mannosyltransferase 1
  • GPI mannosyltransferase I
  • GPI-MT-IPIG-M mannosyltransferase
  • MGC29896
  • phosphatidylinositol glycan anchor biosynthesis, class M
  • phosphatidylinositol glycan, class M
  • Phosphatidylinositol-glycan biosynthesis class M protein
  • PIG-M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-83647
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-62449
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
H00080235-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-05074
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75478
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-31564
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PIGM Antibody (NBP2-13761) (0)

There are no publications for PIGM Antibody (NBP2-13761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGM Antibody (NBP2-13761) (0)

There are no reviews for PIGM Antibody (NBP2-13761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIGM Antibody (NBP2-13761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGM Products

Bioinformatics Tool for PIGM Antibody (NBP2-13761)

Discover related pathways, diseases and genes to PIGM Antibody (NBP2-13761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGM Antibody (NBP2-13761)

Discover more about diseases related to PIGM Antibody (NBP2-13761).
 

Pathways for PIGM Antibody (NBP2-13761)

View related products by pathway.

PTMs for PIGM Antibody (NBP2-13761)

Learn more about PTMs related to PIGM Antibody (NBP2-13761).
 

Research Areas for PIGM Antibody (NBP2-13761)

Find related products by research area.

Blogs on PIGM

There are no specific blogs for PIGM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGM