PIBF1 Antibody (7B7) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related PIBF1 Primary Antibodies

Order Details


    • Catalog Number
      H00010464-M02IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PIBF1 Antibody (7B7) [DyLight 755] Summary

Immunogen
C13orf24 (NP_006337, 660 a.a. ~ 756 a.a) partial recombinant protein with GST tag.EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSE NSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTK KEAPEWSKKQKM
Specificity
C13orf24 - chromosome 13 open reading frame 24
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIBF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 755
Format
DyLight 755 (A=754, E=776)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIBF1 Antibody (7B7) [DyLight 755]

  • C13orf24
  • chromosome 13 open reading frame 24
  • KIAA1008
  • PIBF
  • PIBF1
  • progesterone immunomodulatory binding factor 1
  • progesterone-induced blocking factor 1
  • progesterone-induced-blocking factor 1
  • RP11-505F3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC, ICFlow
MAB27591
Species: Mu
Applications: Flow, ICC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-43123
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF
MAB3717
Species: Hu
Applications: WB, ICC
NBP1-84168
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
AF745
Species: Mu
Applications: WB, Block
H00010464-M02IR
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PIBF1 Antibody (H00010464-M02IR) (0)

There are no publications for PIBF1 Antibody (H00010464-M02IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIBF1 Antibody (H00010464-M02IR) (0)

There are no reviews for PIBF1 Antibody (H00010464-M02IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIBF1 Antibody (H00010464-M02IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIBF1 Antibody (7B7) [DyLight 755] Products

Related Products by Gene

Bioinformatics Tool for PIBF1 Antibody (H00010464-M02IR)

Discover related pathways, diseases and genes to PIBF1 Antibody (H00010464-M02IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIBF1 Antibody (H00010464-M02IR)

Discover more about diseases related to PIBF1 Antibody (H00010464-M02IR).
 

Pathways for PIBF1 Antibody (H00010464-M02IR)

View related products by pathway.

PTMs for PIBF1 Antibody (H00010464-M02IR)

Learn more about PTMs related to PIBF1 Antibody (H00010464-M02IR).

Blogs on PIBF1

There are no specific blogs for PIBF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PIBF1
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00010464-M02IR below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.