PIBF1 Antibody (7B7) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PIBF1 Primary Antibodies

Order Details


    • Catalog Number
      H00010464-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PIBF1 Antibody (7B7) [DyLight 488] Summary

Immunogen
C13orf24 (NP_006337, 660 a.a. ~ 756 a.a) partial recombinant protein with GST tag.EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSE NSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTK KEAPEWSKKQKM
Specificity
C13orf24 - chromosome 13 open reading frame 24
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIBF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIBF1 Antibody (7B7) [DyLight 488]

  • C13orf24
  • chromosome 13 open reading frame 24
  • KIAA1008
  • PIBF
  • PIBF1
  • progesterone immunomodulatory binding factor 1
  • progesterone-induced blocking factor 1
  • progesterone-induced-blocking factor 1
  • RP11-505F3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
AF745
Species: Mu
Applications: WB, Block

Publications for PIBF1 Antibody (H00010464-M02G) (0)

There are no publications for PIBF1 Antibody (H00010464-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIBF1 Antibody (H00010464-M02G) (0)

There are no reviews for PIBF1 Antibody (H00010464-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIBF1 Antibody (H00010464-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIBF1 Products

Bioinformatics Tool for PIBF1 Antibody (H00010464-M02G)

Discover related pathways, diseases and genes to PIBF1 Antibody (H00010464-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIBF1 Antibody (H00010464-M02G)

Discover more about diseases related to PIBF1 Antibody (H00010464-M02G).
 

Pathways for PIBF1 Antibody (H00010464-M02G)

View related products by pathway.

PTMs for PIBF1 Antibody (H00010464-M02G)

Learn more about PTMs related to PIBF1 Antibody (H00010464-M02G).

Blogs on PIBF1

There are no specific blogs for PIBF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIBF1 Antibody (7B7) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PIBF1
Entrez