PIAS2 Antibody (1F7) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PIAS2 Primary Antibodies

Order Details


    • Catalog Number
      H00009063-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PIAS2 Antibody (1F7) [DyLight 488] Summary

Immunogen
PIAS2 (NP_004662, 385 a.a. ~ 474 a.a) partial recombinant protein with GST tag.CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCP MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVD VIDLT
Localization
Nuclear
Specificity
PIAS2 - protein inhibitor of activated STAT, 2
Isotype
IgG Mix Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIAS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIAS2 Antibody (1F7) [DyLight 488]

  • Androgen receptor-interacting protein 3
  • ARIP3
  • DAB2-interacting protein
  • DIP
  • E3 SUMO-protein ligase PIAS2
  • MGC102682
  • miz
  • MIZ1
  • Msx-interacting zinc finger protein
  • Msx-interacting-zinc finger
  • PIAS2
  • PIAS-NY protein
  • PIASx alpha
  • PIASX
  • PIASX-ALPHA
  • PIASX-BETA
  • Protein inhibitor of activated STAT x
  • protein inhibitor of activated STAT, 2
  • Protein inhibitor of activated STAT2
  • SIZ2
  • zinc finger, MIZ-type containing 4
  • ZMIZ4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF7177
Species: Hu
Applications: WB, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P

Publications for PIAS2 Antibody (H00009063-M01G) (0)

There are no publications for PIAS2 Antibody (H00009063-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIAS2 Antibody (H00009063-M01G) (0)

There are no reviews for PIAS2 Antibody (H00009063-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIAS2 Antibody (H00009063-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIAS2 Products

Bioinformatics Tool for PIAS2 Antibody (H00009063-M01G)

Discover related pathways, diseases and genes to PIAS2 Antibody (H00009063-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIAS2 Antibody (H00009063-M01G)

Discover more about diseases related to PIAS2 Antibody (H00009063-M01G).
 

Pathways for PIAS2 Antibody (H00009063-M01G)

View related products by pathway.

PTMs for PIAS2 Antibody (H00009063-M01G)

Learn more about PTMs related to PIAS2 Antibody (H00009063-M01G).

Blogs on PIAS2

There are no specific blogs for PIAS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIAS2 Antibody (1F7) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PIAS2
Entrez