PI 3-Kinase p110 gamma Antibody (2G3) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related PI 3-Kinase p110 gamma Primary Antibodies

Order Details


    • Catalog Number
      H00005294-M02V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PI 3-Kinase p110 gamma Antibody (2G3) [DyLight 405] Summary

Immunogen
PIK3CG (AAH35683, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY
Specificity
PIK3CG (2G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIK3CG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PI 3-Kinase p110 gamma Antibody (2G3) [DyLight 405]

  • 1-phosphatidylinositol 3-kinase
  • EC 2.7.1
  • EC 2.7.1.153
  • p110-gamma
  • p120-PI3K
  • phosphatidylinositol 3 kinase gamma, p110 gamma
  • phosphatidylinositol 3-kinase catalytic 110-kD gamma
  • phosphatidylinositol 3-kinase, catalytic, gamma polypeptide
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  • phosphoinositide-3-kinase gamma catalytic subunit
  • phosphoinositide-3-kinase, catalytic, gamma polypeptide
  • PI 3Kinase p110 gamma
  • PI 3-Kinase p110 gamma
  • PI3CG
  • PI3K
  • PI3K-gamma
  • PI3Kgamma
  • PI3K-gamma
  • PI3-kinase subunit gamma
  • PIK3
  • PIK3CG
  • PtdIns-3-kinase subunit gamma
  • PtdIns-3-kinase subunit p110-gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-32975
Species: Hu, Rt, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC

Publications for PI 3-Kinase p110 gamma Antibody (H00005294-M02V) (0)

There are no publications for PI 3-Kinase p110 gamma Antibody (H00005294-M02V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p110 gamma Antibody (H00005294-M02V) (0)

There are no reviews for PI 3-Kinase p110 gamma Antibody (H00005294-M02V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PI 3-Kinase p110 gamma Antibody (H00005294-M02V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PI 3-Kinase p110 gamma Products

Related Products by Gene

Bioinformatics Tool for PI 3-Kinase p110 gamma Antibody (H00005294-M02V)

Discover related pathways, diseases and genes to PI 3-Kinase p110 gamma Antibody (H00005294-M02V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p110 gamma Antibody (H00005294-M02V)

Discover more about diseases related to PI 3-Kinase p110 gamma Antibody (H00005294-M02V).
 

Pathways for PI 3-Kinase p110 gamma Antibody (H00005294-M02V)

View related products by pathway.

PTMs for PI 3-Kinase p110 gamma Antibody (H00005294-M02V)

Learn more about PTMs related to PI 3-Kinase p110 gamma Antibody (H00005294-M02V).
 

Research Areas for PI 3-Kinase p110 gamma Antibody (H00005294-M02V)

Find related products by research area.

Blogs on PI 3-Kinase p110 gamma

There are no specific blogs for PI 3-Kinase p110 gamma, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p110 gamma Antibody (2G3) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3CG
Entrez