PHOX2A Antibody (4F6) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PHOX2A Primary Antibodies

Order Details


    • Catalog Number
      H00000401-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PHOX2A Antibody (4F6) [DyLight 488] Summary

Immunogen
PHOX2A (NP_005160, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
Specificity
PHOX2A - paired-like (aristaless) homeobox 2a
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHOX2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHOX2A Antibody (4F6) [DyLight 488]

  • aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive
  • aristaless homeobox homolog
  • Aristaless homeobox protein homolog
  • arix homeodomain protein
  • ARIX1 homeodomain protein
  • ARIXNCAM2
  • CFEOM2MGC52227
  • paired mesoderm homeobox protein 2A
  • paired-like homeobox 2apaired-like (aristaless) homeobox 2a
  • PMX2AFEOM2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF2567
Species: Mu
Applications: WB, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
25280002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00000401-M01G
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for PHOX2A Antibody (H00000401-M01G) (0)

There are no publications for PHOX2A Antibody (H00000401-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHOX2A Antibody (H00000401-M01G) (0)

There are no reviews for PHOX2A Antibody (H00000401-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHOX2A Antibody (H00000401-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHOX2A Products

Bioinformatics Tool for PHOX2A Antibody (H00000401-M01G)

Discover related pathways, diseases and genes to PHOX2A Antibody (H00000401-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHOX2A Antibody (H00000401-M01G)

Discover more about diseases related to PHOX2A Antibody (H00000401-M01G).
 

Pathways for PHOX2A Antibody (H00000401-M01G)

View related products by pathway.

PTMs for PHOX2A Antibody (H00000401-M01G)

Learn more about PTMs related to PHOX2A Antibody (H00000401-M01G).
 

Research Areas for PHOX2A Antibody (H00000401-M01G)

Find related products by research area.

Blogs on PHOX2A

There are no specific blogs for PHOX2A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHOX2A Antibody (4F6) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PHOX2A