Phospholipase C delta 1 Antibody

Images

 
Western Blot: Phospholipase C delta 1 Antibody [NBP1-58893] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Product Discontinued
View other related Phospholipase C delta 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58893
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Phospholipase C delta 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PLCD1(phospholipase C, delta 1) The peptide sequence was selected from the N terminal of PLCD1. Peptide sequence HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PLCD1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Phospholipase C delta 1 Antibody

  • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1
  • EC 3.1.4.11
  • Phosphoinositide phospholipase C-delta-1
  • phospholipase C, delta 1
  • Phospholipase C-delta-1
  • Phospholipase C-III
  • PLC-delta-1
  • PLC-III

Background

Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PEP-ELISA
AF4466
Species: Hu, Mu
Applications: WB
NBP2-52533
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF5315
Species: Hu, Mu
Applications: WB
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-91499
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
NBP2-38392
Species: Hu
Applications: IHC, IHC-P
NBP2-58951
Species: Hu
Applications: WB, ICC/IF

Publications for Phospholipase C delta 1 Antibody (NBP1-58893) (0)

There are no publications for Phospholipase C delta 1 Antibody (NBP1-58893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase C delta 1 Antibody (NBP1-58893) (0)

There are no reviews for Phospholipase C delta 1 Antibody (NBP1-58893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholipase C delta 1 Antibody (NBP1-58893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Phospholipase C delta 1 Products

Bioinformatics Tool for Phospholipase C delta 1 Antibody (NBP1-58893)

Discover related pathways, diseases and genes to Phospholipase C delta 1 Antibody (NBP1-58893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase C delta 1 Antibody (NBP1-58893)

Discover more about diseases related to Phospholipase C delta 1 Antibody (NBP1-58893).
 

Pathways for Phospholipase C delta 1 Antibody (NBP1-58893)

View related products by pathway.

PTMs for Phospholipase C delta 1 Antibody (NBP1-58893)

Learn more about PTMs related to Phospholipase C delta 1 Antibody (NBP1-58893).
 

Research Areas for Phospholipase C delta 1 Antibody (NBP1-58893)

Find related products by research area.

Blogs on Phospholipase C delta 1

There are no specific blogs for Phospholipase C delta 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase C delta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCD1
Uniprot