Phospholipase C beta 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Phospholipase C beta 2 Antibody [NBP2-58951] - Staining of human cell line PC-3 shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phospholipase C beta 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPL
Specificity
Specificity of human Phospholipase C beta 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Phospholipase C beta 2 Recombinant Protein Antigen (NBP2-58951PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Phospholipase C beta 2 Antibody

  • EC 3.1.4.11
  • FLJ38135
  • Phosphoinositide phospholipase C-beta-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
  • phospholipase C, beta 2
  • Phospholipase C-beta-2
  • PLC-beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
NBP2-38220
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31974
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5128
Species: Hu, Mu, Rt
Applications: WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-20926
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NB100-98867
Species: Rt
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Phospholipase C beta 2 Antibody (NBP2-58951) (0)

There are no publications for Phospholipase C beta 2 Antibody (NBP2-58951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase C beta 2 Antibody (NBP2-58951) (0)

There are no reviews for Phospholipase C beta 2 Antibody (NBP2-58951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Phospholipase C beta 2 Antibody (NBP2-58951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Phospholipase C beta 2 Antibody (NBP2-58951)

Discover related pathways, diseases and genes to Phospholipase C beta 2 Antibody (NBP2-58951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase C beta 2 Antibody (NBP2-58951)

Discover more about diseases related to Phospholipase C beta 2 Antibody (NBP2-58951).
 

Pathways for Phospholipase C beta 2 Antibody (NBP2-58951)

View related products by pathway.

PTMs for Phospholipase C beta 2 Antibody (NBP2-58951)

Learn more about PTMs related to Phospholipase C beta 2 Antibody (NBP2-58951).
 

Research Areas for Phospholipase C beta 2 Antibody (NBP2-58951)

Find related products by research area.

Blogs on Phospholipase C beta 2.

Bitter Taste Receptor Antibodies Used in New Bronchodilator Study
As one of the world's leading antibody suppliers, Novus Biologicals has an expansive GPCR (G-protein coupled receptor) antibody catalog. Novus antibodies to the bitter taste receptor (TAS2R) have recently been used in a study on TAS2R bronchodilator a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase C beta 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCB2