Phospholipase C beta 2 Antibody


Immunocytochemistry/ Immunofluorescence: Phospholipase C beta 2 Antibody [NBP2-58951] - Staining of human cell line PC-3 shows localization to cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

Phospholipase C beta 2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPL
Specificity of human Phospholipase C beta 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Phospholipase C beta 2 Recombinant Protein Antigen (NBP2-58951PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Phospholipase C beta 2 Antibody

  • EC
  • FLJ38135
  • Phosphoinositide phospholipase C-beta-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
  • phospholipase C, beta 2
  • Phospholipase C-beta-2
  • PLC-beta-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Phospholipase C beta 2 Antibody (NBP2-58951) (0)

There are no publications for Phospholipase C beta 2 Antibody (NBP2-58951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase C beta 2 Antibody (NBP2-58951) (0)

There are no reviews for Phospholipase C beta 2 Antibody (NBP2-58951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Phospholipase C beta 2 Antibody (NBP2-58951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Phospholipase C beta 2 Antibody (NBP2-58951)

Discover related pathways, diseases and genes to Phospholipase C beta 2 Antibody (NBP2-58951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase C beta 2 Antibody (NBP2-58951)

Discover more about diseases related to Phospholipase C beta 2 Antibody (NBP2-58951).

Pathways for Phospholipase C beta 2 Antibody (NBP2-58951)

View related products by pathway.

PTMs for Phospholipase C beta 2 Antibody (NBP2-58951)

Learn more about PTMs related to Phospholipase C beta 2 Antibody (NBP2-58951).

Research Areas for Phospholipase C beta 2 Antibody (NBP2-58951)

Find related products by research area.

Blogs on Phospholipase C beta 2.

Bitter Taste Receptor Antibodies Used in New Bronchodilator Study
As one of the world's leading antibody suppliers, Novus Biologicals has an expansive GPCR (G-protein coupled receptor) antibody catalog. Novus antibodies to the bitter taste receptor (TAS2R) have recently been used in a study on TAS2R bronchodilator a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Phospholipase C beta 2 Antibody and receive a gift card or discount.


Gene Symbol PLCB2