Recombinant Human PHKG1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHKG1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 288 - 387 of Human PHKG1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHKG1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHKG1 Protein

  • EC 2.7.11
  • EC 2.7.11.19
  • PHKG
  • phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform
  • phosphorylase kinase gamma
  • Phosphorylase kinase subunit gamma-1
  • phosphorylase kinase, gamma 1 (muscle)

Background

PHKG1 - phosphorylase kinase, gamma 1 (muscle)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-98474
Species: Hu
Applications: WB
NBP1-92264
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-57900
Species: Hu
Applications: ICC/IF
NBP2-58195
Species: Hu
Applications: ICC/IF
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16689
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81867
Species: Hu
Applications: IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-47404
Species: Hu
Applications: IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
H00005260-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PHKG1 Partial Recombinant Protein (H00005260-Q01) (0)

There are no publications for PHKG1 Partial Recombinant Protein (H00005260-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKG1 Partial Recombinant Protein (H00005260-Q01) (0)

There are no reviews for PHKG1 Partial Recombinant Protein (H00005260-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHKG1 Partial Recombinant Protein (H00005260-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHKG1 Products

Bioinformatics Tool for PHKG1 Partial Recombinant Protein (H00005260-Q01)

Discover related pathways, diseases and genes to PHKG1 Partial Recombinant Protein (H00005260-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHKG1 Partial Recombinant Protein (H00005260-Q01)

Discover more about diseases related to PHKG1 Partial Recombinant Protein (H00005260-Q01).
 

Pathways for PHKG1 Partial Recombinant Protein (H00005260-Q01)

View related products by pathway.

PTMs for PHKG1 Partial Recombinant Protein (H00005260-Q01)

Learn more about PTMs related to PHKG1 Partial Recombinant Protein (H00005260-Q01).
 

Research Areas for PHKG1 Partial Recombinant Protein (H00005260-Q01)

Find related products by research area.

Blogs on PHKG1

There are no specific blogs for PHKG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHKG1 Antibody
NBP1-87280

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHKG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKG1