Recombinant Human PHKA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHKA1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 631 - 730 of Human PHKA1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHKA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHKA1 Protein

  • MGC132604
  • PHKA
  • phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform
  • phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
  • Phosphorylase kinase alpha M subunit
  • phosphorylase kinase, alpha 1 (muscle)
  • phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis

Background

PHKA1 - phosphorylase kinase, alpha 1 (muscle)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92264
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-16689
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-57900
Species: Hu
Applications: ICC/IF
H00006192-P01
Species: Hu
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHKA1 Partial Recombinant Protein (H00005255-Q01) (0)

There are no publications for PHKA1 Partial Recombinant Protein (H00005255-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHKA1 Partial Recombinant Protein (H00005255-Q01) (0)

There are no reviews for PHKA1 Partial Recombinant Protein (H00005255-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHKA1 Partial Recombinant Protein (H00005255-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHKA1 Products

Bioinformatics Tool for PHKA1 Partial Recombinant Protein (H00005255-Q01)

Discover related pathways, diseases and genes to PHKA1 Partial Recombinant Protein (H00005255-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHKA1 Partial Recombinant Protein (H00005255-Q01)

Discover more about diseases related to PHKA1 Partial Recombinant Protein (H00005255-Q01).
 

Pathways for PHKA1 Partial Recombinant Protein (H00005255-Q01)

View related products by pathway.

PTMs for PHKA1 Partial Recombinant Protein (H00005255-Q01)

Learn more about PTMs related to PHKA1 Partial Recombinant Protein (H00005255-Q01).

Blogs on PHKA1

There are no specific blogs for PHKA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHKA1 Antibody
NBP1-87281
PGK1 Antibody
NBP2-19784

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHKA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKA1