PHF1 Antibody (2G7) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PHF1 Primary Antibodies

Order Details


    • Catalog Number
      H00005252-M04PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PHF1 Antibody (2G7) [PerCP] Summary

Immunogen
PHF1 (NP_077084, 2 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Specificity
PHF1 (2G7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHF1 Antibody (2G7) [PerCP]

  • hPCl1
  • MTF2L2
  • PCL1
  • PHD finger protein 1
  • PHF2
  • Polycomb-like protein 1
  • Protein PHF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF6846
Species: Hu
Applications: IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP1-71865
Species: Hu
Applications: WB, IP, PLA
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHF1 Antibody (H00005252-M04PCP) (0)

There are no publications for PHF1 Antibody (H00005252-M04PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF1 Antibody (H00005252-M04PCP) (0)

There are no reviews for PHF1 Antibody (H00005252-M04PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHF1 Antibody (H00005252-M04PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF1 Products

Bioinformatics Tool for PHF1 Antibody (H00005252-M04PCP)

Discover related pathways, diseases and genes to PHF1 Antibody (H00005252-M04PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF1 Antibody (H00005252-M04PCP)

Discover more about diseases related to PHF1 Antibody (H00005252-M04PCP).
 

Pathways for PHF1 Antibody (H00005252-M04PCP)

View related products by pathway.

PTMs for PHF1 Antibody (H00005252-M04PCP)

Learn more about PTMs related to PHF1 Antibody (H00005252-M04PCP).

Blogs on PHF1.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF1 Antibody (2G7) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF1