PGM3 Antibody

Images

 
Western Blot: PGM3 Antibody [NBP1-56957] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PGM3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56957
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PGM3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PGM3(phosphoglucomutase 3) The peptide sequence was selected from the N terminal of PGM3. Peptide sequence IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL.
Clonality
Polyclonal
Host
Rabbit
Gene
PGM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PGM3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PGM3 Antibody

  • AGM1PAGMAcetylglucosamine phosphomutase
  • DKFZP434B187
  • EC 5.4.2
  • EC 5.4.2.3
  • FLJ11614
  • FLJ13623
  • N-acetylglucosamine-phosphate mutase 1
  • N-acetylglucosamine-phosphate mutase
  • PGM 3
  • phosphoacetylglucosamine mutase
  • phosphoglucomutase 3
  • Phosphoglucomutase-3

Background

PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP2-32601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19727
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34980
Species: Hu
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54755
Species: Hu
Applications: WB
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for PGM3 Antibody (NBP1-56957) (0)

There are no publications for PGM3 Antibody (NBP1-56957).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGM3 Antibody (NBP1-56957) (0)

There are no reviews for PGM3 Antibody (NBP1-56957). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGM3 Antibody (NBP1-56957) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGM3 Products

Bioinformatics Tool for PGM3 Antibody (NBP1-56957)

Discover related pathways, diseases and genes to PGM3 Antibody (NBP1-56957). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM3 Antibody (NBP1-56957)

Discover more about diseases related to PGM3 Antibody (NBP1-56957).
 

Pathways for PGM3 Antibody (NBP1-56957)

View related products by pathway.

PTMs for PGM3 Antibody (NBP1-56957)

Learn more about PTMs related to PGM3 Antibody (NBP1-56957).
 

Research Areas for PGM3 Antibody (NBP1-56957)

Find related products by research area.

Blogs on PGM3

There are no specific blogs for PGM3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGM3
Uniprot