Recombinant Human PGLYRP1/PGRP-S Protein

Images

 

Product Details

Summary
Product Discontinued
View other related PGLYRP1/PGRP-S Peptides and Proteins

Order Details


    • Catalog Number
      H00008993-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human PGLYRP1/PGRP-S Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 138-196 of Human PGLYRP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
PGLYRP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PGLYRP1/PGRP-S Protein

  • peptidoglycan recognition protein 1
  • Peptidoglycan recognition protein short
  • PGLYRP
  • PGLYRP1
  • PGRPpeptidoglycan recognition protein
  • PGRPS
  • PGRP-S
  • PGRP-SMGC126894
  • PGRPSMGC126896
  • TAG7
  • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
  • TNFSF3L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP2-49690
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56729
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56721
Species: Hu
Applications: WB, ICC/IF
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-01168
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
H00008993-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01) (0)

There are no publications for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01) (0)

There are no reviews for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGLYRP1/PGRP-S Products

Bioinformatics Tool for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01)

Discover related pathways, diseases and genes to PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01)

Discover more about diseases related to PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01).
 

Pathways for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01)

View related products by pathway.

PTMs for PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01)

Learn more about PTMs related to PGLYRP1/PGRP-S Partial Recombinant Protein (H00008993-Q01).

Blogs on PGLYRP1/PGRP-S

There are no specific blogs for PGLYRP1/PGRP-S, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PGLYRP1/PGRP-S Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PGLYRP1
Entrez