PGLYRP1/PGRP-S Antibody

Images

 
Western Blot: PGLYRP1/PGRP-S Antibody [H00008993-D01P] - Analysis of PGLYRP1 expression in transfected 293T cell line by PGLYRP1 polyclonal antibody.Lane 1: PGLYRP1 transfected lysate(21.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGLYRP1/PGRP-S Antibody Summary

Immunogen
PGLYRP1 (NP_005082.1, 1 a.a. - 196 a.a.) full-length human protein. MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Specificity
Reacts with peptidoglycan recognition protein 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGLYRP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PGLYRP1/PGRP-S Antibody

  • peptidoglycan recognition protein 1
  • Peptidoglycan recognition protein short
  • PGLYRP
  • PGLYRP1
  • PGRPpeptidoglycan recognition protein
  • PGRPS
  • PGRP-S
  • PGRP-SMGC126894
  • PGRPSMGC126896
  • TAG7
  • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
  • TNFSF3L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP2-49690
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56729
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56721
Species: Hu
Applications: WB, ICC/IF
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-01168
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
H00008993-D01P
Species: Hu
Applications: WB

Publications for PGLYRP1/PGRP-S Antibody (H00008993-D01P) (0)

There are no publications for PGLYRP1/PGRP-S Antibody (H00008993-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGLYRP1/PGRP-S Antibody (H00008993-D01P) (0)

There are no reviews for PGLYRP1/PGRP-S Antibody (H00008993-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGLYRP1/PGRP-S Antibody (H00008993-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGLYRP1/PGRP-S Products

Bioinformatics Tool for PGLYRP1/PGRP-S Antibody (H00008993-D01P)

Discover related pathways, diseases and genes to PGLYRP1/PGRP-S Antibody (H00008993-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGLYRP1/PGRP-S Antibody (H00008993-D01P)

Discover more about diseases related to PGLYRP1/PGRP-S Antibody (H00008993-D01P).
 

Pathways for PGLYRP1/PGRP-S Antibody (H00008993-D01P)

View related products by pathway.

PTMs for PGLYRP1/PGRP-S Antibody (H00008993-D01P)

Learn more about PTMs related to PGLYRP1/PGRP-S Antibody (H00008993-D01P).

Blogs on PGLYRP1/PGRP-S

There are no specific blogs for PGLYRP1/PGRP-S, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGLYRP1/PGRP-S Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGLYRP1
Entrez
Uniprot