PGGT1B Antibody (5E4.) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related PGGT1B Primary Antibodies

Order Details


    • Catalog Number
      H00005229-M02V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PGGT1B Antibody (5E4.) [DyLight 405] Summary

Immunogen
PGGT1B (NP_005014, 1 a.a. - 105 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPF
Specificity
PGGT1B - protein geranylgeranyltransferase type I, beta subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PGGT1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluorescence, immunohistochemistry (paraffin sections) and ELISA.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PGGT1B Antibody (5E4.) [DyLight 405]

  • BGGI
  • EC 2.5.1
  • EC 2.5.1.59
  • Geranylgeranyl transferase type I subunit beta
  • geranylgeranyl transferase type-1 subunit beta
  • geranylgeranyltransferase type I beta subunit
  • GGTase-I-beta
  • GGTI
  • protein geranylgeranyltransferase type I, beta subunit
  • Type I protein geranyl-geranyltransferase subunit beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF1555
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-47560
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
H00005229-M02V
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PGGT1B Antibody (H00005229-M02V) (0)

There are no publications for PGGT1B Antibody (H00005229-M02V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGGT1B Antibody (H00005229-M02V) (0)

There are no reviews for PGGT1B Antibody (H00005229-M02V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGGT1B Antibody (H00005229-M02V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGGT1B Antibody (5E4.) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for PGGT1B Antibody (H00005229-M02V)

Discover related pathways, diseases and genes to PGGT1B Antibody (H00005229-M02V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGGT1B Antibody (H00005229-M02V)

Discover more about diseases related to PGGT1B Antibody (H00005229-M02V).
 

Pathways for PGGT1B Antibody (H00005229-M02V)

View related products by pathway.

Blogs on PGGT1B

There are no specific blogs for PGGT1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGGT1B Antibody (5E4.) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol PGGT1B