PGA5 Antibody (4G9) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PGA5 Primary Antibodies

Order Details


    • Catalog Number
      H00005222-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PGA5 Antibody (4G9) [DyLight 488] Summary

Immunogen
PGA5 (NP_055039 203 a.a. - 306 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD
Specificity
PGA5 - pepsinogen 5, group I (pepsinogen A)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PGA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PGA5 Antibody (4G9) [DyLight 488]

  • EC 3.4.23
  • EC 3.4.23.1
  • pepsin A
  • pepsinogen 5, group I (pepsinogen A)
  • Pepsinogen A5
  • PGA3
  • PGA4
  • PGA5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48988
Species: Hu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-81610
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005222-M02G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PGA5 Antibody (H00005222-M02G) (0)

There are no publications for PGA5 Antibody (H00005222-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGA5 Antibody (H00005222-M02G) (0)

There are no reviews for PGA5 Antibody (H00005222-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGA5 Antibody (H00005222-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGA5 Products

Bioinformatics Tool for PGA5 Antibody (H00005222-M02G)

Discover related pathways, diseases and genes to PGA5 Antibody (H00005222-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGA5 Antibody (H00005222-M02G)

Discover more about diseases related to PGA5 Antibody (H00005222-M02G).
 

Pathways for PGA5 Antibody (H00005222-M02G)

View related products by pathway.

Blogs on PGA5

There are no specific blogs for PGA5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGA5 Antibody (4G9) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PGA5
Entrez