Recombinant Human PEX14 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PEX14 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 293 - 375 of Human PEX14 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PEX14
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PEX14 Protein

  • dJ734G22.2
  • MGC12767
  • NAPP2
  • NF-E2 associated polypeptide 2
  • peroxin-14
  • peroxisomal biogenesis factor 14
  • Peroxisomal membrane anchor protein PEX14
  • peroxisomal membrane anchor protein Pex14p
  • peroxisomal membrane protein PEX14
  • Pex14p
  • PTS1 receptor docking protein
  • PTS1 receptor-docking protein

Background

This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49599
Species: Hu
Applications: WB, IHC
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46476
Species: Hu
Applications: WB, IHC
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PEX14 Partial Recombinant Protein (H00005195-Q01) (0)

There are no publications for PEX14 Partial Recombinant Protein (H00005195-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX14 Partial Recombinant Protein (H00005195-Q01) (0)

There are no reviews for PEX14 Partial Recombinant Protein (H00005195-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX14 Partial Recombinant Protein (H00005195-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX14 Products

Bioinformatics Tool for PEX14 Partial Recombinant Protein (H00005195-Q01)

Discover related pathways, diseases and genes to PEX14 Partial Recombinant Protein (H00005195-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX14 Partial Recombinant Protein (H00005195-Q01)

Discover more about diseases related to PEX14 Partial Recombinant Protein (H00005195-Q01).
 

Pathways for PEX14 Partial Recombinant Protein (H00005195-Q01)

View related products by pathway.

PTMs for PEX14 Partial Recombinant Protein (H00005195-Q01)

Learn more about PTMs related to PEX14 Partial Recombinant Protein (H00005195-Q01).

Blogs on PEX14

There are no specific blogs for PEX14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PEX14 Antibody
NBP2-33556
PHGDH Antibody
NBP1-87311

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PEX14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX14