Recombinant Human PEX11G Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PEX11G Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 21 - 120 of Human PEX11G partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PEX11G

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PEX11G Protein

  • MGC4281
  • peroxin Pex11p gamma
  • peroxin-11C
  • peroxisomal biogenesis factor 11 gamma
  • Peroxisomal biogenesis factor 11C
  • peroxisomal biogenesis factor 11G
  • peroxisomal membrane protein 11C
  • PEX11C
  • PEX11-gamma
  • Protein PEX11 homolog gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59704
Species: Hu
Applications: WB
NBP2-13750
Species: Hu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57200
Species: Hu
Applications: ICC/IF
8090-ZN
Species: Hu
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00092960-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PEX11G Partial Recombinant Protein (H00092960-Q01) (0)

There are no publications for PEX11G Partial Recombinant Protein (H00092960-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX11G Partial Recombinant Protein (H00092960-Q01) (0)

There are no reviews for PEX11G Partial Recombinant Protein (H00092960-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX11G Partial Recombinant Protein (H00092960-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX11G Products

Bioinformatics Tool for PEX11G Partial Recombinant Protein (H00092960-Q01)

Discover related pathways, diseases and genes to PEX11G Partial Recombinant Protein (H00092960-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX11G Partial Recombinant Protein (H00092960-Q01)

Discover more about diseases related to PEX11G Partial Recombinant Protein (H00092960-Q01).
 

Pathways for PEX11G Partial Recombinant Protein (H00092960-Q01)

View related products by pathway.

Blogs on PEX11G

There are no specific blogs for PEX11G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DRP1 Antibody
NB110-55288
PEX11G Antibody
NBP2-49620

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PEX11G Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX11G