PERP Antibody


Western Blot: PERP Antibody [NBP1-69450] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: PANC1 cell lysate PERP is supported by BioGPS gene expression data to be expressed in PANC1
Immunohistochemistry: PERP Antibody [NBP1-69450] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: 1:100 Other Working more

Product Details

Product Discontinued
View other related PERP Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PERP Antibody Summary

Synthetic peptides corresponding to PERP(PERP, TP53 apoptosis effector) The peptide sequence was selected from the middle region of PERP. Peptide sequence FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PERP and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
PERP Lysate (NBP2-66282)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PERP Antibody

  • dJ496H19.1
  • KCP1KCP-1
  • Keratinocyte-associated protein 1
  • KRTCAP11110017A08Rik
  • p53 apoptosis effector related to PMP22
  • p53 apoptosis effector related to PMP-22
  • P53-induced protein PIGPC1
  • PERP, TP53 apoptosis effector
  • PIGPC1RP3-496H19.1
  • THWkeratinocytes associated protein 1
  • Transmembrane protein THW


PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC

Publications for PERP Antibody (NBP1-69450) (0)

There are no publications for PERP Antibody (NBP1-69450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PERP Antibody (NBP1-69450) (0)

There are no reviews for PERP Antibody (NBP1-69450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PERP Antibody (NBP1-69450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PERP Products

Bioinformatics Tool for PERP Antibody (NBP1-69450)

Discover related pathways, diseases and genes to PERP Antibody (NBP1-69450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PERP Antibody (NBP1-69450)

Discover more about diseases related to PERP Antibody (NBP1-69450).

Pathways for PERP Antibody (NBP1-69450)

View related products by pathway.

PTMs for PERP Antibody (NBP1-69450)

Learn more about PTMs related to PERP Antibody (NBP1-69450).

Research Areas for PERP Antibody (NBP1-69450)

Find related products by research area.

Blogs on PERP

There are no specific blogs for PERP, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PERP Antibody and receive a gift card or discount.


Gene Symbol PERP