Peroxiredoxin Like 2C Antibody

Images

 
Immunohistochemistry: Peroxiredoxin Like 2C Antibody [NBP1-91073] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry: Peroxiredoxin Like 2C Antibody [NBP1-91073] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Peroxiredoxin Like 2C Antibody [NBP1-91073] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Peroxiredoxin Like 2C Antibody [NBP1-91073] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Peroxiredoxin Like 2C Antibody [NBP1-91073] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Peroxiredoxin Like 2C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
Specificity
Specificity of human C9orf21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AAED1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Peroxiredoxin Like 2C Antibody

  • AhpC/TSA antioxidant enzyme domain containing 1
  • C9orf21
  • chromosome 9 open reading frame 21
  • hypothetical protein LOC195827

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4707
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-58701
Species: Hu
Applications: ICC/IF

Publications for Peroxiredoxin Like 2C Antibody (NBP1-91073) (0)

There are no publications for Peroxiredoxin Like 2C Antibody (NBP1-91073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin Like 2C Antibody (NBP1-91073) (0)

There are no reviews for Peroxiredoxin Like 2C Antibody (NBP1-91073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Peroxiredoxin Like 2C Antibody (NBP1-91073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Peroxiredoxin Like 2C Products

Bioinformatics Tool for Peroxiredoxin Like 2C Antibody (NBP1-91073)

Discover related pathways, diseases and genes to Peroxiredoxin Like 2C Antibody (NBP1-91073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Peroxiredoxin Like 2C

There are no specific blogs for Peroxiredoxin Like 2C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin Like 2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AAED1
COVID-19 update